powered by:
Protein Alignment Cpr65Ax1 and CPR147
DIOPT Version :9
Sequence 1: | NP_001097523.1 |
Gene: | Cpr65Ax1 / 5740751 |
FlyBaseID: | FBgn0086900 |
Length: | 102 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024667074.1 |
Gene: | CPR147 / 1271153 |
VectorBaseID: | AGAP012462 |
Length: | 181 |
Species: | Anopheles gambiae |
Alignment Length: | 66 |
Identity: | 21/66 - (31%) |
Similarity: | 35/66 - (53%) |
Gaps: | 4/66 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 DSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQ 90
|:||....||:.....|.||.::.|.:::. :...|.|.:..:.|||:...|.|.||:||::
Mosquito 90 DANVQPAKYSFEYNVQDFTSGNDFGHMESR----DGDRTVGRYFVLLPDGRKQVVNYEADQNGYR 150
Fly 91 P 91
|
Mosquito 151 P 151
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.