DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL2 and cox7a2a

DIOPT Version :10

Sequence 1:NP_001097054.1 Gene:COX7AL2 / 5740746 FlyBaseID:FBgn0085201 Length:62 Species:Drosophila melanogaster
Sequence 2:NP_001027900.1 Gene:cox7a2a / 554103 ZFINID:ZDB-GENE-050522-153 Length:83 Species:Danio rerio


Alignment Length:59 Identity:23/59 - (38%)
Similarity:33/59 - (55%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVHLVYTMGFAKKK 61
            |.:.:.||.|:||..|:|||.||||..|.:|:.:|..|...|....|:.::.....|||
Zfish    24 LENKVPNKQKLFQEDNDLPVHLKGGLTDGLLYRLTMALTIFGSGYVVYTLFDAAMPKKK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7AL2NP_001097054.1 Cyt_c_Oxidase_VIIa 3..57 CDD:238468 20/53 (38%)
cox7a2aNP_001027900.1 Cyt_c_Oxidase_VIIa 24..78 CDD:238468 20/53 (38%)

Return to query results.
Submit another query.