DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL2 and Cox7a2l

DIOPT Version :10

Sequence 1:NP_001097054.1 Gene:COX7AL2 / 5740746 FlyBaseID:FBgn0085201 Length:62 Species:Drosophila melanogaster
Sequence 2:NP_001153001.1 Gene:Cox7a2l / 20463 MGIID:106015 Length:134 Species:Mus musculus


Alignment Length:38 Identity:10/38 - (26%)
Similarity:17/38 - (44%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LKGGPADKILFGITAGLCGLGIVSFVHLVYTMGFAKKK 61
            ||.|..|::|:..|..|...|.:..:..:|.....:.|
Mouse    97 LKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7AL2NP_001097054.1 Cyt_c_Oxidase_VIIa 3..57 CDD:238468 9/32 (28%)
Cox7a2lNP_001153001.1 Cyt_c_Oxidase_VIIa 55..130 CDD:238468 9/32 (28%)

Return to query results.
Submit another query.