DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7AL2 and Cox7a2

DIOPT Version :10

Sequence 1:NP_001097054.1 Gene:COX7AL2 / 5740746 FlyBaseID:FBgn0085201 Length:62 Species:Drosophila melanogaster
Sequence 2:NP_034075.2 Gene:Cox7a2 / 12866 MGIID:1316715 Length:83 Species:Mus musculus


Alignment Length:52 Identity:20/52 - (38%)
Similarity:29/52 - (55%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVHLVYTMGFAKKK 61
            |.|:||..|.:||.||||.:|.:|:..|..|...|....::|:....|.||:
Mouse    31 KQKLFQEDNGMPVHLKGGASDALLYRATMALTLGGTAYAIYLLAMAAFPKKQ 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7AL2NP_001097054.1 Cyt_c_Oxidase_VIIa 3..57 CDD:238468 17/46 (37%)
Cox7a2NP_034075.2 Cyt_c_Oxidase_VIIa 24..78 CDD:238468 17/46 (37%)

Return to query results.
Submit another query.