DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG34428

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097597.2 Gene:CG34428 / 5740867 FlyBaseID:FBgn0085457 Length:247 Species:Drosophila melanogaster


Alignment Length:302 Identity:66/302 - (21%)
Similarity:106/302 - (35%) Gaps:99/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFGFFRNSQEKFVW----CTGGASSLFV-AIALPL-DLRFEKAFLSYNFEVSYDLPRSWKQKPPF 70
            :|...|:.:....|    .|.....:|: .|.:|| ||.:|.....|..:|.|.||.:    |..
  Fly    24 LFKHQRSKRAPIPWLIYPTTSPTRVMFIGGIGIPLEDLNYEAVTTGYVLKVEYWLPTT----PDD 84

  Fly    71 LRHGNGTNDESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVI 135
            ||                                                         .|.::.
  Fly    85 LR---------------------------------------------------------TPTALP 92

  Fly   136 KPQKNKPKHKHKKKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYII 200
            ..|...|.....:|.: ||.         :::|..|  :|.:|      :.:|.||:||. ..:.
  Fly    93 LTQVATPGVTGARKQR-KPM---------FENFLVG--VDELG------KNTRKLLTRTN-KVLS 138

  Fly   201 NHRFE----LHGLG-----AGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSS---RYEEL 253
            ::|:.    |.||.     .|..|:|:.||||........||:...|:|::.:||||   ..|..
  Fly   139 SYRWTVYKGLEGLADRLGYQGRICVLKSICEAAEEPFHYTNGLFADLLHILLTPSSSVDKLSEHA 203

  Fly   254 PKRYYIAELDGRNG-NCGGYRVQCEHSVLDMITQPVKNKNKM 294
            ...||.||..|::| .|.....:|..|:|...::...|.:|:
  Fly   204 DNEYYYAEKMGQSGAGCDRVFKECRRSLLQHFSELHHNLDKI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 29/95 (31%)
CG34428NP_001097597.2 DM4_12 139..234 CDD:214785 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.