DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG34442

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097311.1 Gene:CG34442 / 5740603 FlyBaseID:FBgn0085471 Length:245 Species:Drosophila melanogaster


Alignment Length:281 Identity:81/281 - (28%)
Similarity:126/281 - (44%) Gaps:64/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FLVL-LIFGFFRNSQEKFVWCTGGASSLFVAIALPLDLRFEKAFLSYNFEVSYDLPRSWKQKPPF 70
            ||.| .|...|...:...::.|.....:|:||::|:.|.....|||||:|.:|..|....:.||.
  Fly    10 FLFLCAIINNFNLVKSALLFTTNSEYGIFMAISVPIGLPHRNVFLSYNYEFNYYQPEHVYKYPPI 74

  Fly    71 LRHGNGTNDESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVI 135
            |                   ...||  :|.|.....:|.:.:.:|..:..|.|.:      |::.
  Fly    75 L-------------------MGQDF--EDSYLTYPTTGREAEGRHCQNCTDWKIE------GNIN 112

  Fly   136 KPQKNKPKHKHKKKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYII 200
            ....|....|                                  :..|:::..:|:||:.||.::
  Fly   113 STSSNNNSTK----------------------------------AASREKRGLTLMSRSVFYAML 143

  Fly   201 NHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKRYYIAELDGR 265
            ..:....|..| :.|||||||:.|:.|||::||.||||:|::||||||:.|.||..||.||.|||
  Fly   144 RDKLRRSGFPA-EPCLLRLICDTNASQLGEVNGFLGSLVHIIFSPSSSKDEHLPNEYYQAEWDGR 207

  Fly   266 -NGNCGGYRVQCEHSVLDMIT 285
             ...|..|...|:|::||:::
  Fly   208 EQQECSTYTKSCDHNILDLVS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 41/83 (49%)
CG34442NP_001097311.1 DM4_12 136..219 CDD:285126 41/83 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438014
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 1 1.000 - - FOG0008553
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.