DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG34443

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097312.1 Gene:CG34443 / 5740580 FlyBaseID:FBgn0085472 Length:239 Species:Drosophila melanogaster


Alignment Length:297 Identity:91/297 - (30%)
Similarity:140/297 - (47%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTFLVLLIFGFFRNSQEKFVWCTGGAS-SLFVAIALPLDLRFEKAFLSYNFEVSYDLPRSWKQKP 68
            |...:|.::....||   ||..|..:: .:|.|||:||:|.....|:|||||.:|:||.:|::..
  Fly     9 GLVFLLTVYLDLTNS---FVAFTASSTHGIFAAIAVPLELPHRNVFVSYNFEANYNLPANWEKWT 70

  Fly    69 PFLRHGNGTNDESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGS 133
            .|                    ||.....::..|:...              :..:|.:......
  Fly    71 IF--------------------QNGPIESEEVVDETDT--------------ETDRKLAAGCQNC 101

  Fly   134 VIKPQKNKPKHKHKKKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYY 198
            .:|.:......              ||:|              :.|.:.::|:.||||:|:..|.
  Fly   102 TVKEENEAGSE--------------EVEE--------------ITEVLPQERKVRSLLTRSNIYR 138

  Fly   199 IINHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKRYYIAELD 263
            |...:.:..|. .|:|||||||||.::.||.:.|||||||:||:||||||..|:||.|||.||.|
  Fly   139 IFVDKLKRSGF-RGESCLLRLICETSAAQLDEFNGVLGSLMHVLFSPSSSESEDLPLRYYQAEHD 202

  Fly   264 GRNGNCGGYRVQCEHSVLDMITQPVKN------KNKM 294
            |.||:|..|...|..|:|::|::|.::      :||:
  Fly   203 GWNGHCHVYEPGCGESILELISEPFEDIFKHIERNKI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 45/82 (55%)
CG34443NP_001097312.1 DM4_12 133..215 CDD:285126 45/82 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H117634
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105960at33392
OrthoFinder 1 1.000 - - FOG0008553
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.