DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG13616

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651262.1 Gene:CG13616 / 42917 FlyBaseID:FBgn0039200 Length:231 Species:Drosophila melanogaster


Alignment Length:119 Identity:29/119 - (24%)
Similarity:50/119 - (42%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 GMGESVGRDRQSRSLLSRTKFYYIINHRFELHGLGAGDSCLLRLICEANSYQLGDL--NGVLGSL 238
            |:..::.:|...|.  ||..||..:...|:..|.. |.||:.|.:||:..:.|..:  ..:|..|
  Fly   100 GLNATLAKDTIKRR--SRRAFYDEVQSLFDNMGFN-GRSCVARALCESAKFMLPSVERGNMLQEL 161

  Fly   239 IHVMFS--PS---------SSRYEELPKRYYIAELDGRNGNCGGYRVQCEHSVL 281
            :..:||  ||         ..:|:.:.:|...:..|     |......|:.|:|
  Fly   162 VRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKRSSRD-----CHEIYPGCQFSLL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 22/95 (23%)
CG13616NP_651262.1 DM4_12 110..212 CDD:214785 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.