DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG17780

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:106 Identity:23/106 - (21%)
Similarity:42/106 - (39%) Gaps:32/106 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRFELHGLGAGDSCLLR 218
            |.|..|..:.|...||:.|              .|.|.|:      :....:.||.. |.:|:|:
  Fly   117 PFPSIEEQKKDNAVFFRLF--------------KRDLFSK------LETALDGHGFD-GRACMLK 160

  Fly   219 LICEANSYQLGDL------NGVLGSLIHVMFSPSSSRYEEL 253
            ..|.|    :.|:      :|:|..::.::|. .:.||.::
  Fly   161 SFCTA----INDVDNPKQKSGMLFKMLKLIFR-RAKRYLDI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 13/67 (19%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:285126 13/62 (21%)
DM4_12 253..338 CDD:214785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.