DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG17782

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_651257.1 Gene:CG17782 / 42912 FlyBaseID:FBgn0039195 Length:479 Species:Drosophila melanogaster


Alignment Length:266 Identity:50/266 - (18%)
Similarity:94/266 - (35%) Gaps:58/266 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SYNFEVSY--DLPRSWKQKPP---FLRHG---NGTNDESLLSDHHGHHQNDDFVY--------DD 99
            |:.:..||  ..|:..::|..   :.|.|   :.:|..:..:..:.|.||..:.|        |.
  Fly   229 SHRYADSYYSSRPKGGRRKDNHYYYSRPGVSSSSSNPFAKWTRPYSHAQNSRYPYWALNSRLKDR 293

  Fly   100 YYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPKHKHKK---------------K 149
            ||      |.|.:....|....::...:.....:..:|.: :|..:|.:               .
  Fly   294 YY------GYKSQQAAPPAAQRRQDSTTTTSAPTTSRPTR-RPAPRHHRIYPVFGKRSIPDAANP 351

  Fly   150 HKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSR-SLLSRTKFYYIINHRFELHGLGAGD 213
            ||.:.:.....:.:|.....:..       .:...|:|| ||..|.:.|  ::.|.. |    |.
  Fly   352 HKRQRRSGVATEHEDKMSRLEQL-------QIKHHRRSRQSLYERIEKY--LDKRGH-H----GH 402

  Fly   214 SCLLRLICEANSYQLGDLNGV-LGSLIHVMFSPSSSRYEELPKRYYIAELD---GRNGNCGGYRV 274
            .|:||.:||..........|. :|.|:..:|:...:...| |..|..:..|   ....:|.....
  Fly   403 HCVLRTLCETGQKSTEHEPGTFVGELMRAVFTLPEAMDNE-PVAYRDSHYDKAHASKADCAVLYP 466

  Fly   275 QCEHSV 280
            :|:.|:
  Fly   467 ECKQSM 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 19/86 (22%)
CG17782NP_651257.1 DM4_12 378..475 CDD:214785 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.