DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG13613

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097900.2 Gene:CG13613 / 42910 FlyBaseID:FBgn0039193 Length:219 Species:Drosophila melanogaster


Alignment Length:296 Identity:54/296 - (18%)
Similarity:87/296 - (29%) Gaps:109/296 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIFGFFRNSQEKFVWCTGGASSLFVAIALPLDLRFE-KAFLSYNFEVSYDLPRSWKQKPPFLRH 73
            ||:....|......::.|.....|..:|::|.||... |.|:...|:::|:||      |.....
  Fly    17 LLLITLIRPIYGLLLFPTSTVLQLTSSISIPADLNTRTKVFMDMGFQMNYNLP------PTVSAF 75

  Fly    74 GNGTNDESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHK----HHPHHHDKKKKKSKPKPGSV 134
            .|.|    :.:|.....|....       |.....|..::.    .||                 
  Fly    76 YNAT----IWADELSRRQKRQL-------DHSLDANLQQYDLEGGMHP----------------- 112

  Fly   135 IKPQKNKPKHKHKKKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYI 199
                                           .||..|                       :.|..
  Fly   113 -------------------------------ADFTAG-----------------------QLYKG 123

  Fly   200 INHRFELHGLGAGDSCLLRLICE------ANSYQLGDLNGVLGSLI----HVMFSPSSSRYEELP 254
            |.:..|.:|...  |||||.:||      |..:..|.:..|:..|:    |..|:.....|.:  
  Fly   124 IENMLETYGFHR--SCLLRSVCELALHPFAEDHFYGMVTQVITFLLTPSQHEGFADDEQHYRD-- 184

  Fly   255 KRYYIAELDG-RNGNCGGYRVQCEHSVLDMITQPVK 289
             :|..||..| ..|.|......|:..::::.|:.|:
  Fly   185 -KYEKAEQIGFLGGQCHLSYPSCQADIINLATRLVR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 24/93 (26%)
CG13613NP_001097900.2 DM4_12 119..206 CDD:285126 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.