DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG7201

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001261574.1 Gene:CG7201 / 38929 FlyBaseID:FBgn0035865 Length:345 Species:Drosophila melanogaster


Alignment Length:277 Identity:58/277 - (20%)
Similarity:95/277 - (34%) Gaps:86/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GFFRNSQEKFVWCTGGASSLFVAIALPLDLRFEKAFLSYNFEVSYDLPRSWKQKPPFLRHGNGTN 78
            |||.|                :.|:.|:.:.|:|..|:.|.....|||      |.|.|.     
  Fly   105 GFFSN----------------LTISFPVTIDFDKLGLTDNQNPLGDLP------PLFARS----- 142

  Fly    79 DESLLSDHHGHHQNDDFVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPK 143
                 ..|...|...::|                   ..:.|.:::|:.       :..|:::..
  Fly   143 -----FGHEAGHMVGEYV-------------------ARYLHVQRRKRD-------LSEQRSRSN 176

  Fly   144 HKHK-KKHKSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRFELH 207
            ..|. :.|:..|| .||:.. ..:..|.|      ||             |...|.::.......
  Fly   177 EDHPFRIHEEGPK-YPELPA-GLQHIFHG------GE-------------RVLLYGVVEDFLSTF 220

  Fly   208 GLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKRYYIAELDGRN----GN 268
            |:. |.:||||.|||.:|..| :..||.|.:..:..:.:.|.:.:|...|..|:..|..    |.
  Fly   221 GMD-GKACLLRTICEMHSRSL-EKFGVFGEMTKLFLTVTKSPFSDLVPDYVQAQEVGEGKQAPGE 283

  Fly   269 CGGYRVQCEHSVLDMIT 285
            |..|...|..|:...::
  Fly   284 CFPYFKDCPKSIFKALS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 24/86 (28%)
CG7201NP_001261574.1 DM4_12 201..298 CDD:214785 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.