DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG33262

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_996071.2 Gene:CG33262 / 2768975 FlyBaseID:FBgn0053262 Length:208 Species:Drosophila melanogaster


Alignment Length:268 Identity:54/268 - (20%)
Similarity:85/268 - (31%) Gaps:112/268 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 FVA-IALPLDLRFEKAFLSYNFEVSYDLPRS---WKQKPPFLRHGNGTNDESLLSDHHGHHQNDD 94
            |:| |.:|.||.:|...:.|..:..|.||.:   ::|.|.|                        
  Fly    46 FIAGIGIPADLEYESLTVGYVLKAEYYLPYNATVYRQNPLF------------------------ 86

  Fly    95 FVYDDYYDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPKHKHKKKHKSKPKPPPE 159
                                                           |::|           |..
  Fly    87 -----------------------------------------------PEYK-----------PNT 93

  Fly   160 VDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYIINHRFELHGLGAGDSCLLRLICEAN 224
            :|..|.:..|.. |.|                .|.:.|..|.|....:||. |.:|||..|||||
  Fly    94 IDAQDQRKLFMK-PTD----------------LRWQLYQFIEHMLNGYGLN-GHACLLEAICEAN 140

  Fly   225 SYQLGDLNGVLGSLIHVMFSPSSSRYEELPKR--YYIAELDGRNGNCGGYRVQCEHSVLDMITQP 287
            :.:........|.::|::.||||:...|..:.  :.:||.||...:|..|  .|...:::..:  
  Fly   141 NIKFAKDFSTAGEMLHLLLSPSSTLNSESNRALDFILAEKDGSRRDCSKY--DCNTKIINWFS-- 201

  Fly   288 VKNKNKMH 295
              ..|||:
  Fly   202 --FVNKMN 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 28/84 (33%)
CG33262NP_996071.2 DM4_12 110..192 CDD:285126 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.