DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34444 and CG33342

DIOPT Version :9

Sequence 1:NP_001097313.1 Gene:CG34444 / 5740745 FlyBaseID:FBgn0085473 Length:295 Species:Drosophila melanogaster
Sequence 2:NP_001097904.1 Gene:CG33342 / 2768684 FlyBaseID:FBgn0086610 Length:219 Species:Drosophila melanogaster


Alignment Length:96 Identity:23/96 - (23%)
Similarity:42/96 - (43%) Gaps:5/96 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SRTKFYYIINHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRYEELPKR 256
            :|...|.::....|..|.....:|||:.|||.:...... |.:.|.:::.:..||   .:.:|::
  Fly   122 TRVWLYDVVETGLERLGDRNAGACLLKCICEISQRPFMH-NSIFGEILNAVLVPS---LDNVPEK 182

  Fly   257 YYIAELDGRNG-NCGGYRVQCEHSVLDMITQ 286
            |..|...|:.| ||......|..:..:.:.|
  Fly   183 YLHARNAGKAGANCRKTYSDCSKAFWNKLIQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34444NP_001097313.1 DM4_12 193..276 CDD:285126 21/83 (25%)
CG33342NP_001097904.1 DM4_12 123..203 CDD:285126 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21398
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.