DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG34290

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:295 Identity:70/295 - (23%)
Similarity:125/295 - (42%) Gaps:76/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WMLANQGSAQLLDQNCAEVSRLSNDIIFS-------RPWMAL---VLLPNKT--------CSGAL 58
            |:|.:.....:| ::|..|..:...|:.:       .|:|..   |:..|.|        |.|:|
  Fly    15 WLLHSLFIISVL-ESCHAVPIVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSYQHFCGGSL 78

  Fly    59 IHKYFVITSASCVFNQE----------RAIVRLGQLSIKQEHIVSYSSDDYHVQSA-YIHRFYEK 112
            |...:::::|.||:.:.          ..|..:|||            ..|.::|. ||  :::.
  Fly    79 ISDRWILSAAHCVWRKNIHYIAAFIGYENIENIGQL------------QPYGLESVEYI--YFQP 129

  Fly   113 SNFEHDIALLELQ--------NDVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDEKYILPA 169
            |||.:|||||.::        |.:.| |.:.|..:..|::: ..::.....|...|..:|.:..|
  Fly   130 SNFRNDIALLYMKRRYWSDFGNGLQY-AQLPPHGMKPDQNE-SCRIIGYGATHHAGPCQKRLFEA 192

  Fly   170 AKTSKIKHISQVKCENAFK--LYPQN--SHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFG 229
                :::.|...||.:...  ..|||  :.:||...|:..|. ::|.||   |..|....| ::|
  Fly   193 ----EVRVIDNQKCRDIIGHIWAPQNGANTVCALGNNQDSCQGDSGGPL---ICTYGGKDY-IYG 249

  Fly   230 IQSYGESRTC-------LYTDVTKYIDWIMGVIQN 257
            :.|:|  .||       :||....|.||:..::|:
  Fly   250 LVSHG--LTCGIPGMPSIYTVTRPYYDWVQLLMQS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 63/260 (24%)
Tryp_SPc 40..251 CDD:214473 62/259 (24%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 64/268 (24%)
Tryp_SPc 34..276 CDD:214473 63/267 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.