DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG9737

DIOPT Version :10

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:260 Identity:76/260 - (29%)
Similarity:125/260 - (48%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWMALVLLPNKT--CSGALIHKYFVITSASCVFNQERAI--------VRLGQLSIKQE------- 89
            ||:||::..:..  ||||||....::|:|.||  |...:        ||||:.::|.|       
  Fly   162 PWLALLVYNSNDYGCSGALIDDRHILTAAHCV--QGEGVRDRQGLKHVRLGEFNVKTEPDCIEEP 224

  Fly    90 HIVSYSSD--DYHVQSAYIHRFY-EKSNFEH-DIALLELQNDVLYKAHIRPICLWLDKSD----I 146
            :.:|.:..  |...:..::|..| |.||::: |||::.|::.|.:...:.|||| .:||:    .
  Fly   225 NYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSFTHFVMPICL-PNKSEPLTLA 288

  Fly   147 DTQMFKRYETFRWG---IDEKYIL----PAAKTSKIKHISQVKCEN-----AFKLYPQNSHICAG 199
            :.|||   ....||   :..||.:    |.....:|.::|...|..     ..:|.|:  .||||
  Fly   289 EGQMF---SVSGWGRTDLFNKYFINIHSPIKLKLRIPYVSNENCTKILEGFGVRLGPK--QICAG 348

  Fly   200 YK-NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYG------ESRTCLYTDVTKYIDWIMGVIQ 256
            .: .|..|. ::|.||....|.::  |:..:|:.|||      ..:..:||:|.:|.|||..|:|
  Fly   349 GEFAKDTCAGDSGGPLMYFDRQHS--RWVAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVVQ 411

  Fly   257  256
              Fly   412  411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:473915 73/254 (29%)
CG9737NP_651783.1 CLIP 28..89 CDD:463440
Tryp_SPc 149..406 CDD:214473 72/253 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.