DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and grass

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_651543.1 Gene:grass / 43273 FlyBaseID:FBgn0039494 Length:377 Species:Drosophila melanogaster


Alignment Length:289 Identity:79/289 - (27%)
Similarity:123/289 - (42%) Gaps:65/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DQN--CAEV--SRLSNDI---IFSRPWMALVLL-----PNKTCSGALIHKYFVITSASCVFNQER 76
            |:|  |...  .|:||..   :.|||||||:..     ....|.||:|.:.:::|:|.||...:.
  Fly   106 DENFDCGNFLSQRVSNGYEVKLSSRPWMALLRYQQFGESRFLCGGAMISERYILTAAHCVHGLQN 170

  Fly    77 AI--VRLGQLSIKQEHIVSYSSD---------------DYHVQSAYIHRFYEKSNFEHDIALLEL 124
            .:  :|||      ||.:|...|               :..::...||..|:..:..||||||:|
  Fly   171 DLYEIRLG------EHRISTEEDCRQQGRKKKCAPPVVNVGIEKHLIHEKYDARHIMHDIALLKL 229

  Fly   125 QNDVLYKAHIRPICLWL-DKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQV------K 182
            ...|.::.||:||||.: |:.....:....|....||..|.     ..:|.:...:.|      .
  Fly   230 NRSVPFQKHIKPICLPITDELKEKAEQISTYFVTGWGTTEN-----GSSSDVLLQANVPLQPRSA 289

  Fly   183 CENAFKLYPQNSHICAGYKN-KSKCV-ETGSPLFKKIRYYTKI--RYTLFGIQSYGESRTC---- 239
            |..|::.....|.:|.|..: :..|. ::|.||....:|..:.  :...|||.|.|.. ||    
  Fly   290 CSQAYRRAVPLSQLCVGGGDLQDSCKGDSGGPLQAPAQYLGEYAPKMVEFGIVSQGVV-TCGQIS 353

  Fly   240 ---LYTDVTKYIDWIMGVIQNVNVIVSNG 265
               |||:|.:|:.||      .:.:.|||
  Fly   354 LPGLYTNVGEYVQWI------TDTMASNG 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 69/251 (27%)
Tryp_SPc 40..251 CDD:214473 68/250 (27%)
grassNP_651543.1 CLIP 32..90 CDD:197829
Tryp_SPc 121..371 CDD:238113 71/267 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.