DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG9631

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650345.1 Gene:CG9631 / 41729 FlyBaseID:FBgn0027563 Length:439 Species:Drosophila melanogaster


Alignment Length:242 Identity:65/242 - (26%)
Similarity:108/242 - (44%) Gaps:49/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWMAL----VLLPNKTCSGALIHKYFVITSASCVFNQ--ERAIVRLGQLSIKQ--EHIVSYSSDD 98
            ||:|.    |......|..::|.|..|||:|.|::.:  .:..|.||:....:  |:..|..|  
  Fly   209 PWLAALYEGVGTATYKCVVSVISKRTVITAAHCIYGKSASQLWVYLGRHDRNENPENGASLVS-- 271

  Fly    99 YHVQSAYIHRFYEKSNF-EHDIALLELQNDVLYKAHIRPICLW-----LDKSDIDTQMFKRYETF 157
              |.|......||.:.. :.|:.||.|.:.::|..:|||:|||     |..::.||.     ...
  Fly   272 --VTSVLTPSAYEGNPVPDADVGLLVLTSPMVYTKYIRPLCLWGSNMGLPPNEGDTG-----AVA 329

  Fly   158 RWGID---EKYILPAAKTSKIKHISQVKCENAFKL---YPQNSHICAG-YKNKSKCV-ETGSPL- 213
            .||.|   :|...|  ||..::.:.:.:|....|.   :.....:||| .::...|. ::||.| 
  Fly   330 GWGYDRSAQKTRFP--KTVSVRLVPRDQCLKEMKRAEDFITRRTVCAGNSESHGPCFGDSGSALI 392

  Fly   214 -FKKIRYYTKIRYTLFGIQS----YGE----SRTCLYTDVTKYIDWI 251
             .:..|:|.:      |:.|    :||    |:..:|.||.::|||:
  Fly   393 VLRNNRWYVR------GVVSLSPRHGEICDLSKYVIYCDVARHIDWV 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 65/242 (27%)
Tryp_SPc 40..251 CDD:214473 64/240 (27%)
CG9631NP_650345.1 GD_N 26..127 CDD:292649
Tryp_SPc 198..436 CDD:238113 65/242 (27%)
Tryp_SPc 198..433 CDD:214473 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.