DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG11668

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_650254.1 Gene:CG11668 / 41606 FlyBaseID:FBgn0038113 Length:398 Species:Drosophila melanogaster


Alignment Length:267 Identity:55/267 - (20%)
Similarity:107/267 - (40%) Gaps:59/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QNCAEVSRLSNDIIFSRPWMALVLLPNKT-----------------CSGALIHKYFVITSASC-- 70
            ||.....||:.:  ...|:|..:..|::|                 |..|:|...|.||:|.|  
  Fly   145 QNLLVGGRLTQE--NEHPYMCALGWPSRTNRWIHEHGSSKRRYTFNCGCAMIAPRFAITAAHCAS 207

  Fly    71 VFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIR 135
            |..:..::..:|.:.:.     |.......::....|..::.....:|:|:::|..    ::|:.
  Fly   208 VGGESPSVALIGGVELN-----SGRGQLIEIKRISQHPHFDAETLTNDLAVVKLAR----RSHMP 263

  Fly   136 PICLWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKT---SKIKHISQVKCENAFKLYPQ----- 192
            ..|||..:|..:..:    ....:| ..|:..|.:..   ..:.|::..:|:.....|.:     
  Fly   264 VACLWNQESLPERPL----TALGYG-QTKFAGPHSSNLLQIMLYHLNFQQCQRYLHNYDKLANGL 323

  Fly   193 -NSHICAG-YK-NKSKCV-ETGSPLF--KKIRYYTKIRYTL---FGIQSYG----ESRTCLYTDV 244
             :..:||| |. |...|. ::|.||.  :.:|::   |:|:   .||.|:|    ..:..:|..:
  Fly   324 GSGQMCAGDYSGNMDTCQGDSGGPLLLHQHMRHH---RHTIPYVVGITSFGGACASGQPGVYVRI 385

  Fly   245 TKYIDWI 251
            ..||.||
  Fly   386 AHYIQWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 51/252 (20%)
Tryp_SPc 40..251 CDD:214473 49/250 (20%)
CG11668NP_650254.1 Tryp_SPc 149..395 CDD:238113 53/263 (20%)
Tryp_SPc 149..392 CDD:214473 51/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.