DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG12951

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:299 Identity:59/299 - (19%)
Similarity:115/299 - (38%) Gaps:83/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MLANQG---------SAQLLDQNCAEVSRLSN---DIIFSRPWMALVLL--PNKTCSGALIHKYF 63
            ||:||.         :...:.|....:||:.|   ..:...|::..:..  .:.:|.|::|.|:|
  Fly     1 MLSNQDLSLSLIVILAVTTVGQAAPSISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHF 65

  Fly    64 VITSASCVFNQ--ERAIVRLGQLSIKQ--------EHIVSYSSDDYHVQSAYIHRFYEKSNFEHD 118
            |:|:|.|...:  :...::.|..:|..        :.|:.:...|...|:|            :|
  Fly    66 VMTAAHCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNA------------ND 118

  Fly   119 IALLELQNDVLYK-AHIRPI-----CLWLDKSDIDTQMFKRYETFRWGIDEKY--ILPAAKTSKI 175
            |:||.::....:. ..:.|:     ...:.:||...:..    ...||:::.|  :....:...:
  Fly   119 ISLLMVEEPFEFDGVSVAPVELPALAFAVPQSDAGVEGV----LIGWGLNDTYGSVQDTLQEVSL 179

  Fly   176 KHISQVKCENAF--KLYPQNSHICAGYK--NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYG- 234
            |..|..:|.:..  :..|: .|||.|..  .|.:|. ::|.||             ::..|..| 
  Fly   180 KIYSDEECTSRHNGQTDPK-YHICGGVDEGGKGQCSGDSGGPL-------------IYNGQQVGI 230

  Fly   235 ---ESRTC-------LYTDVTKYIDWIMGVIQNVNVIVS 263
               ..:.|       :|..|::|:|||..     |.|:|
  Fly   231 VSWSIKPCTVAPYPGVYCKVSQYVDWIKS-----NQIIS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 47/247 (19%)
Tryp_SPc 40..251 CDD:214473 46/246 (19%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 48/257 (19%)
Tryp_SPc 30..260 CDD:238113 49/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455951
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.