DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and MP1

DIOPT Version :10

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:251 Identity:65/251 - (25%)
Similarity:105/251 - (41%) Gaps:47/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWMALV--LLPNKT----CSGALIHKYFVITSASCV----FNQERAIVRLGQLSIKQEHIVSYSS 96
            |||||:  ..|...    |.|:||:..:|:|:|.||    .:.|...||||:.........:...
  Fly   150 PWMALIEYTKPGNVKGHHCGGSLINHRYVLTAAHCVSAIPSDWELTGVRLGEWDASTNPDCTVGK 214

  Fly    97 D----------DYHVQSAYIHRFYEKSNFE--HDIALLELQNDVLYKAHIRPICL-WLDKSDIDT 148
            :          ||.|:....|..|..::.:  :|||||.|:::|.|...|.|:|| .|.....:.
  Fly   215 NGRRDCNEPYVDYPVEERIPHPQYPGNSRDQLNDIALLRLRDEVQYSDFILPVCLPTLASQHNNI 279

  Fly   149 QMFKRYETFRWGIDEKYILPAAKTSKIKHISQV------KCENAFKLYPQ---NSHICA-GYKNK 203
            .:.::.....||..|...     ||.||..:::      :|...:....:   ...:|| |.:..
  Fly   280 FLGRKVVVAGWGRTETNF-----TSNIKLKAELDTVPTSECNQRYATQRRTVTTKQMCAGGVEGV 339

  Fly   204 SKC-VETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-------LYTDVTKYIDWI 251
            ..| .::|.||..:........|.:.|:.|||.: .|       :||.|..|::||
  Fly   340 DSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGPT-PCGLKGWPGVYTRVEAYLNWI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:473915 65/251 (26%)
MP1NP_001303421.1 CLIP 29..91 CDD:463440
Tryp_SPc 138..397 CDD:238113 65/251 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.