DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and mas

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_523919.1 Gene:mas / 38499 FlyBaseID:FBgn0011653 Length:1047 Species:Drosophila melanogaster


Alignment Length:243 Identity:63/243 - (25%)
Similarity:104/243 - (42%) Gaps:37/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WMALVLLPNK----TCSGALIHKYFVITSASCVFNQERA----IVRLGQLSIKQEHIVSYSSDDY 99
            |...|.|.|.    .|..|||...:|:|:|.||.|..|:    .||:|...:.::: .|..:...
  Fly   814 WCWQVALINSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAIYVRVGDYDLTRKY-GSPGAQTL 877

  Fly   100 HVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIRP-ICL-WLDKSDIDTQMFKRYETFRWG-I 161
            .|.:.|||..:.....::|||||:|..    :|.:|. :|| .|....:.....||.....:| :
  Fly   878 RVATTYIHHNHNSQTLDNDIALLKLHG----QAELRDGVCLVCLPARGVSHAAGKRCTVTGYGYM 938

  Fly   162 DEKYILP-AAKTSKIKHISQVKC--------ENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKK 216
            .|...:| ..:.::|..:|..:|        |..| :.|.:|....|.:....|. :.|.||..:
  Fly   939 GEAGPIPLRVREAEIPIVSDTECIRKVNAVTEKIF-ILPASSFCAGGEEGHDACQGDGGGPLVCQ 1002

  Fly   217 IRYYTKIRYTLFGIQSYG-----ESRTCLYTDVTKYIDWIMGVIQNVN 259
            ...:    |.|.|:.|:|     :....:|...:.:|.||..:| :||
  Fly  1003 DDGF----YELAGLVSWGFGCGRQDVPGVYVKTSSFIGWINQII-SVN 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 59/234 (25%)
Tryp_SPc 40..251 CDD:214473 58/233 (25%)
masNP_523919.1 Tryp_SPc 803..1041 CDD:238113 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.