DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30283

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:275 Identity:85/275 - (30%)
Similarity:130/275 - (47%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWMLANQGSAQLLDQNCAEV--SRLS-----NDIIFSRPWMALVLLPNK-TCSGALIHKYF 63
            ||..|.::....|...|:..|..|  |:..     |..:.|.||||:|:.... .|.|.||...|
  Fly    13 LAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVMGEGGFHCGGTLITNRF 77

  Fly    64 VITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDV 128
            |:|||.|:.|.|.. ||||.|..:.|      :..:.|.:.::|..|...  :||:|||.|...|
  Fly    78 VLTSAHCIANGELK-VRLGVLEREAE------AQKFAVDAMFVHTDYYFD--QHDLALLRLAKRV 133

  Fly   129 LYKAHIRPICLWLDK--SDIDTQMFKRYETFRWGIDEKYILP--AAKTSKIKHISQVKCENAFKL 189
            .|..:|.||||.||.  .:||..:.| :.|:.||..|.....  ..||| :.::.:.:|.   |.
  Fly   134 HYSDNISPICLLLDPLVKNIDEHIVK-FRTYGWGKTESRSSSRMLQKTS-LFNLHRSECA---KQ 193

  Fly   190 YP----QNSHICAGYKNKSKC-VETGSPLFKKIRYYTKIRYTLFGIQSYGE---SRTCLYTDVTK 246
            ||    ..:||||...|.:.| .::|.||...:.|........||:.|:|.   |:..::|:|..
  Fly   194 YPHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMT 258

  Fly   247 YIDWIMGVIQNVNVI 261
            ::|||:..::...::
  Fly   259 HLDWIVNTVRRAEIM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 75/224 (33%)
Tryp_SPc 40..251 CDD:214473 74/223 (33%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 75/234 (32%)
Tryp_SPc 43..266 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.