DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG14760

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_610366.1 Gene:CG14760 / 35802 FlyBaseID:FBgn0033277 Length:529 Species:Drosophila melanogaster


Alignment Length:245 Identity:53/245 - (21%)
Similarity:103/245 - (42%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IIFSRPWMALVLLPNK---TCSGALIHKYFVITSASCVFNQE-------RAIVRLGQLSIKQEHI 91
            ::...|.||.||....   .|..|:||..:::::|.|....|       |.:|....|:...|  
  Fly   284 VLHEFPPMAGVLTKKHGKVFCGAAIIHHRYLLSAAHCFLGPETNSAAKLRVVVGEHDLASSFE-- 346

  Fly    92 VSYSSDDYHVQSAYIHRFYEKSNFE--HDIALLELQNDVLYKAHIRPICLWLDKSDIDTQ----- 149
             ::::..|.:.:..:|..:.:::.:  :|||:|:.:..:::..|:.|.||.|...: |.|     
  Fly   347 -TFATQRYDLDALILHEDFSQASGQPKNDIAMLKTRMAIVWSQHVGPACLPLQPGE-DGQKLPLA 409

  Fly   150 ----MFKRYETFRWGIDEKYILPAAKTSKIKHISQVKCENAFK----LYPQNSHICAGYKNKSKC 206
                :...:.|..:|..:.:.|..|   .:..|...:|..|..    |.|..  .|.....:..|
  Fly   410 GHQVVAAGWGTTSYGGPQTHRLLKA---TLDVIDGRRCRQALSSAGGLPPHT--FCTYTPGRDTC 469

  Fly   207 -VETGSPLFKKIRYYTKIRYTLFGIQSYGES----RTCLYTDVTKYIDWI 251
             .::|..|:::|..    |....||.|:|::    :..:.|.|..:|.||
  Fly   470 QYDSGGALYERING----RLMAVGIVSFGQACAAQQPSVNTRVASFIKWI 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 53/242 (22%)
Tryp_SPc 40..251 CDD:214473 51/240 (21%)
CG14760NP_610366.1 CUB 37..126 CDD:294042
Tryp_SPc 281..516 CDD:238113 53/245 (22%)
Tryp_SPc 281..515 CDD:214473 51/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455910
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.