DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG18477

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_609763.1 Gene:CG18477 / 34922 FlyBaseID:FBgn0028864 Length:464 Species:Drosophila melanogaster


Alignment Length:288 Identity:80/288 - (27%)
Similarity:120/288 - (41%) Gaps:51/288 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLDQNCAEVSRLSNDIIFS-------------RPWMALVLLPNKTCS----GALIHKYFVITSAS 69
            :.|..|..|:  |..:.||             .||| :.||..:|.|    ||||..:.|||:..
  Fly    88 ITDPQCGFVN--SKGVTFSFREEDTGLAQEAEVPWM-VALLDARTSSYVAGGALIAPHVVITARQ 149

  Fly    70 CVFNQ--ERAIVRLGQ--LSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLY 130
            ...|.  .:.:||.|:  .|.|.|.:.|.   |..::|...|..:...|..:::||:.|:..:..
  Fly   150 RTENMTASQLVVRAGEWDFSTKTEQLPSV---DVPIRSIVRHPGFNLENGANNVALVFLRRSLTS 211

  Fly   131 KAHIRPICLWLDKSDIDTQMFKRYETFRWG---IDEKYILPAAKTSKIKHISQVKCENAFKLY-- 190
            ..||.|||:.....:.|   |.|.....||   .|:...:...|...:..:.:..||...:||  
  Fly   212 SRHINPICMPSAPKNFD---FSRCIFTGWGKNSFDDPSYMNVLKKISLPVVQRRTCEQQLRLYYG 273

  Fly   191 ----PQNSHICAGYK-NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-------LYT 242
                ..||.:|||.: .|..|. :.||||...|:...: ||.|.||.::|..  |       :||
  Fly   274 NDFELDNSLMCAGGEPGKDSCEGDGGSPLACAIKDNPQ-RYELAGIVNFGVD--CGLPGVPAVYT 335

  Fly   243 DVTKYIDWIMGVIQNVNVIVSNGENSYA 270
            :|...|:||.....|:.:.....|..||
  Fly   336 NVANVIEWITLTTVNMPLPEEREEVPYA 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 70/250 (28%)
Tryp_SPc 40..251 CDD:214473 69/249 (28%)
CG18477NP_609763.1 Tryp_SPc 113..344 CDD:214473 68/240 (28%)
Tryp_SPc 113..344 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.