DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and Ser7

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:111/271 - (40%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NDIIFSRPWMALVLLPNKT--------CSGALIHKYFVITSASCVFNQERAIVR--LGQLSIKQE 89
            |..:|..||  ..||..:|        |..:.|.:.:::|:|.|:....|.:..  ||:.:...:
  Fly   137 NTGLFEFPW--TTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWNRDTD 199

  Fly    90 ----------------HIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDV--LYKAHIRP 136
                            ||      ...:.....|..|.:.|:.:|||||.|...|  |...::.|
  Fly   200 PDCENDLNGVRECAPPHI------RVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEP 258

  Fly   137 ICLWLDKSDIDTQMF-KRYETFRWGIDEKYILPAAKTSKIK-----HIS-QVKCENAF----KLY 190
            :||...:.....|:. ...:...||..|     ::.:||||     ||. |.:|:.||    |:.
  Fly   259 VCLPPQRGRYANQLAGSAADVSGWGKTE-----SSGSSKIKQKAMLHIQPQDQCQEAFYKDTKIT 318

  Fly   191 PQNSHICAGYK-NKSKCV-ETGSPLFKKIRYYTKIRYT-LFGIQSYGESRTC-------LYTDVT 245
            ..:|.:|||.: ....|. ::|.||..:....:..||. |.|:.|.|. :.|       :||.|:
  Fly   319 LADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGR-KHCGTALFSGIYTRVS 382

  Fly   246 KYIDWIMGVIQ 256
            .|:|||...|:
  Fly   383 SYMDWIESTIR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 65/260 (25%)
Tryp_SPc 40..251 CDD:214473 64/259 (25%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 66/264 (25%)
Tryp_SPc 133..391 CDD:238113 68/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.