DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG32260

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_728942.1 Gene:CG32260 / 317943 FlyBaseID:FBgn0052260 Length:575 Species:Drosophila melanogaster


Alignment Length:247 Identity:69/247 - (27%)
Similarity:103/247 - (41%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PWM------------ALVLLPNKTCSGALIHKYFVITSASCVFNQERAIVRLGQLSIKQEHIVSY 94
            ||:            ||..|    |.|:|||..:|||||.|: |....:||||...:.|.  ...
  Fly   340 PWIAALGYFEENNRNALKFL----CGGSLIHSRYVITSAHCI-NPMLTLVRLGAHDLSQP--AES 397

  Fly    95 SSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIRPICLWLDKSDIDTQMFKRYETF-- 157
            .:.|..::...:|..::.::..:||||:||........:|.|||| .:.:....|.|.....|  
  Fly   398 GAMDLRIRRTVVHEHFDLNSISNDIALIELNVVGALPGNISPICL-PEAAKFMQQDFVGMNPFVA 461

  Fly   158 RWGIDEKYILPAAK----TSKIKHISQV------KCENAFKLYPQ-----NSHICAGYKNKSKCV 207
            .||        |.|    ||::...:||      .||.::|...|     :..:|||..:...|.
  Fly   462 GWG--------AVKHQGVTSQVLRDAQVPIVSRHSCEQSYKSIFQFVQFSDKVLCAGSSSVDACQ 518

  Fly   208 -ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-------LYTDVTKYIDWI 251
             ::|.||..........|:.|.|:.|:|..  |       :||.|..|:.||
  Fly   519 GDSGGPLMMPQLEGNVYRFYLLGLVSFGYE--CARPNFPGVYTRVASYVPWI 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 69/247 (28%)
Tryp_SPc 40..251 CDD:214473 67/245 (27%)
CG32260NP_728942.1 CLIP 194..244 CDD:288855
Tryp_SPc 327..568 CDD:214473 67/245 (27%)
Tryp_SPc 328..571 CDD:238113 69/247 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455961
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.