DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG18420

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:279 Identity:88/279 - (31%)
Similarity:131/279 - (46%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFASCLAVLSWMLANQGSAQLLDQNCAEVS------RLSNDIIF---SRPWMALVLLPNK--TC 54
            :..||.|.:|: :....||.|.||..|...|      |:.|..:.   |.||||.:...:.  .|
  Fly     6 IGMASILLLLT-VFPLLGSTQFLDSECGTRSPLKLGPRIVNGKVAVRNSSPWMAFLHTSSNQFIC 69

  Fly    55 SGALIHKYFVITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDI 119
            .|.||.:..|:|:|.|.......:||||:.:.|   :..| .:::.|...:.||||:.:...:||
  Fly    70 GGTLISRRLVLTAAHCFIPNTTIVVRLGEYNRK---LKGY-REEHQVNRTFQHRFYDPNTHANDI 130

  Fly   120 ALLELQNDVLYKAHIRPICLWLD---KSDIDTQMFKRYETFRWGIDEK-YILPAAKTSKIKHISQ 180
            |||.|.::|:|||:|||||:..|   |..||:  .|......||..|. :.....:|..|.....
  Fly   131 ALLRLVSNVVYKANIRPICIMWDASWKHHIDS--IKVLTGTGWGRTESMHDSSELRTLDISRQPS 193

  Fly   181 VKCENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGE--SRTCLYT 242
            ..|  ||.....| ..|||..|.:.|: :||.|:...:||....|:...||....:  .|..::|
  Fly   194 KMC--AFGSVLSN-QFCAGNWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQRPSVFT 255

  Fly   243 DVTKYIDWIMGVI--QNVN 259
            ||..:|::|..:.  ||.|
  Fly   256 DVMSHIEFIRRIFLTQNGN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 71/220 (32%)
Tryp_SPc 40..251 CDD:214473 71/219 (32%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 73/230 (32%)
Tryp_SPc 43..267 CDD:238113 73/232 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.