DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG33226

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:123/276 - (44%) Gaps:31/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWMLANQGSAQLLDQNCA--------EVSRLSNDIIFSRPWMALVLLPN-KTCSGALIHKY 62
            ||:.|:....|   .|||.||.        ::....|..|...|||..:|... ..|.|:||...
  Fly    19 LALRSYESLGQ---DLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSL 80

  Fly    63 FVITSASCVFNQERAIVRLGQLS-IKQEHIVS--YSS---DDYHVQSAYIHRFYEKSNFEHDIAL 121
            ||:|:|.| .::.|..||.|:.| |...::.|  |.|   .:..|:..::|..| :....:||||
  Fly    81 FVLTAAHC-HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSY-RDYHNYDIAL 143

  Fly   122 LELQNDVLYKAHIRPICLWLDKSDIDTQMFKRY----ETFRWGIDEKYILPA-AKTSKIKHISQV 181
            ..|...|.|....||||:....:....:.|..|    ....||..|..:... .:|:.:.|:.:.
  Fly   144 FLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRK 208

  Fly   182 KCENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC----LY 241
            .|...|.......|||||:...|.|. ::|.||..::.:....|..||||.||| :..|    ::
  Fly   209 FCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG-APNCREVTVF 272

  Fly   242 TDVTKYIDWIMGVIQN 257
            |:|.:|.:||..::.|
  Fly   273 TNVLRYSNWIRDIVHN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 68/228 (30%)
Tryp_SPc 40..251 CDD:214473 67/227 (30%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 71/240 (30%)
Tryp_SPc 47..282 CDD:214473 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.