DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG33462

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:127/277 - (45%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NFASCLAVLS--WMLANQGSAQLLDQNCAEVSRLS----NDIIFSRPWMALVLLPNK-TCSGALI 59
            ||...:||:.  |... ||...||:::|.....:|    |..:...||||.:..|.. .|||.||
  Fly     3 NFIIGIAVICCLWRRV-QGFQMLLEEDCGIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLI 66

  Fly    60 HKYFVITSASCVFNQERAIVRLGQLSIK-----QEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDI 119
            :..||:|:|.||.:.....||||:.:.|     ..|:......:|:|...:.||:|..::..:||
  Fly    67 NHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDI 131

  Fly   120 ALLELQNDVLYKAHIRPICLWLD---KSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQV 181
            .:|.|...|.|..||||||::..   :..||...:  :.|..|  .|......:|..:..:|.:.
  Fly   132 GMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTW--FTTTVW--RETAANATSKVLRTMNIDRQ 192

  Fly   182 KCENAFKLYPQN---SHICAGYKNKSKC-VETGSPLFKKIRYYTKIRYTLFGIQS--YGESRTC- 239
            ..|...::|..|   ..||||......| .::|:|..:|:.:....||...||.|  .|:.:.. 
  Fly   193 PKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSG 257

  Fly   240 LYTDVTKYIDWIMGVIQ 256
            :..|:..|.|||..|::
  Fly   258 ILMDLLSYADWIKRVVR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/227 (30%)
Tryp_SPc 40..251 CDD:214473 66/226 (29%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 68/227 (30%)
Tryp_SPc 48..269 CDD:214473 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.