DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG33461

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:284 Identity:76/284 - (26%)
Similarity:138/284 - (48%) Gaps:34/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNFASCLAVLS-WMLANQGSAQL-LDQNCAEVSRLSNDIIFSR-------PWMALVLLPNK-TCS 55
            :...:.:|.|: ::|...||:.: |::||..|.|||..||...       ||||.:..|.. .|:
  Fly     4 LEMKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLCA 68

  Fly    56 GALIHKYFVITSASCVFNQERAIVRLGQ------LSIKQEHIVSYSSDDYHVQSAYIHRFYEKSN 114
            |:||:::||:|||.|:.:....|.|||:      :..:....:. ::.:|:|...:.||.|:..:
  Fly    69 GSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLE-ATQEYNVDMLFKHRLYDPKD 132

  Fly   115 FEHDIALLELQNDVLYKAHIRPICLWLD-KSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHI 178
            |.:||.:|.|:..|.|..||:|||::.. :..:.......::...||:....:  ..|:|::  :
  Fly   133 FSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFKATGWGLTSTDL--NTKSSRV--L 193

  Fly   179 SQVK--------CENAFKLYPQNSHICAGYKNKSKC-VETGSPLFKKIRYYTKIRYTLFGIQSY- 233
            .::.        |...||....:..||||..:.:.| .::|.|..:.:..:...|:...||.|: 
  Fly   194 MELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQGRYVLIFGMKRFVQMGIASFT 258

  Fly   234 --GESRTCLYTDVTKYIDWIMGVI 255
              ..|:..:.|||.:|..||..|:
  Fly   259 YENCSKVSILTDVVRYGRWIKKVV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 60/238 (25%)
Tryp_SPc 40..251 CDD:214473 59/237 (25%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 61/241 (25%)
Tryp_SPc 42..281 CDD:238113 63/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.