DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30289

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:316 Identity:82/316 - (25%)
Similarity:128/316 - (40%) Gaps:71/316 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CLAVLSWMLANQGSAQLLDQNCAEVSRLSND-------------IIFSRPWMALVLLPNKTCSGA 57
            ||.:.:    |...::||.:||.    :|.|             .|...|||.|| ..:|.|.|:
  Fly    13 CLFIAN----NNVMSRLLVENCG----ISKDDPYVPNIFGGAKTNIQENPWMVLV-WSSKPCGGS 68

  Fly    58 LIHKYFVITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAY--------IHRFYEKSN 114
            ||.:.||:|:|.|| :.|...||||.......  :.|..:::.:...|        :|..|....
  Fly    69 LIARQFVLTAAHCV-SFEDLYVRLGDYETLDP--MPYCLNNHCIPKFYNISVDMKIVHENYNGIT 130

  Fly   115 FEHDIALLELQNDVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDE-----KYILPAAKTSK 174
            .::|||||.:...|.|..::|||||.:.:   ..|....:....||..|     :.:|.|.    
  Fly   131 LQNDIALLRMSEAVEYSDYVRPICLLVGE---QMQSIPMFTVTGWGETEYGQFSRILLNAT---- 188

  Fly   175 IKHISQVKCENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRT 238
            :.::....|...|......|.||||....:.|. ::|.||..|..|..::....:|:.|||..|.
  Fly   189 LYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNRLLSFQYGLVSYGSERC 253

  Fly   239 C-----LYTDVTKYIDWI--------------------MGVIQNVNVIVSNGENSY 269
            .     :||:|:.:.:||                    :|...|:..|:.|.|..|
  Fly   254 AANVAGVYTNVSYHREWIFNKMVQFKPTGHTTFWLSKLVGQTCNITDIIRNIELMY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 66/250 (26%)
Tryp_SPc 40..251 CDD:214473 64/229 (28%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 65/239 (27%)
Tryp_SPc 42..271 CDD:238113 65/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.