DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30286

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:133/280 - (47%) Gaps:38/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVLSWMLANQGSAQLLDQNCAEVS--RLSND----IIFSRPWMALVLLPNK-TCSGALIHKYFVI 65
            ::|.|  ....:||.|:.:|..:|  .|.|:    .|...||||.:....: .|.|.|::..|::
  Fly     9 SLLPW--HPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFIL 71

  Fly    66 TSASCVFNQERAIVRLGQLSIKQEHIVSYS---------SDDYHVQSAYIHRFYEKSNFEHDIAL 121
            |:|.|:...|...||||:.:    .:.|..         |:|:.:..|:.|..|.::|..|||.|
  Fly    72 TAAHCIREDENLTVRLGEFN----SLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGL 132

  Fly   122 LELQNDVLYKAHIRPICLWLDKSDIDTQM--FKRYETFRWGID----EKYILPAAKTSKIKHISQ 180
            |.|...|.||.||:|||| :..:.:..::  ..|.....||..    ..:||   |:.::..::.
  Fly   133 LRLAKSVEYKVHIKPICL-ITNTTLQPKIERLHRLVATGWGRSPSEAANHIL---KSIRVTRVNW 193

  Fly   181 VKCENAFKLYPQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTCL---- 240
            ..|...:.:..:...||..:::...|. ::|.|:.:.||...::.:...||.|||.:. ||    
  Fly   194 GVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE-CLSPSV 257

  Fly   241 YTDVTKYIDWIMGVIQNVNV 260
            :|:|.::|||||..:...::
  Fly   258 FTNVMEHIDWIMAALSTTHI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 64/232 (28%)
Tryp_SPc 40..251 CDD:214473 63/231 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 65/238 (27%)
Tryp_SPc 39..268 CDD:214473 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.