DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30187

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:277 Identity:87/277 - (31%)
Similarity:143/277 - (51%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWMLANQGSAQLLDQNCA-----EVSRLSNDIIFSRPWMALVLLPNKT---CSGALIHKYF 63
            :.|:.|.|.:.|::..|||.|.     :::...|....:..|||.|  .|:|   |.|.||||.|
  Fly     8 IPVIFWFLKDVGASIFLDQICGINIALKITGGHNAAFQNSVWMAAV--HNRTHFICGGTLIHKRF 70

  Fly    64 VITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYE-KSNFEHDIALLELQND 127
            |:|:|.|:.:|:...|.||..:      .|..:|...|.:|.:|..:: ::::|:||.||:|.:|
  Fly    71 VLTAAHCIVDQDVQSVSLGAYN------KSDPADRKDVITAVVHSSFDVRASYENDIGLLKLSSD 129

  Fly   128 VLYKAHIRPICLWLDKSDID-TQMFKRYETFRWGIDEKYILPAAKTSKI------KHISQVKCEN 185
            |::.|.|||||:.|:||..: .:..:.::.|.||     .|...|||.|      .|:.:.:|..
  Fly   130 VIFNALIRPICIVLNKSMANHMRNMRTFKAFGWG-----TLRGNKTSDILQTIILNHLDREECYM 189

  Fly   186 AFKLYPQNSHICAGYKNKSKC-VETGSPLFKKIRYYTKI--RYTLFGIQSYGESRTC----LYTD 243
            ...:||....||||..:...| .::|.||...: :...|  |...|||.|.|:: :|    :|||
  Fly   190 ELSVYPSEKQICAGVPSGDTCGGDSGGPLTNDV-FIQGIGNREVQFGIISVGKT-SCDGQGVYTD 252

  Fly   244 VTKYIDWIMGVIQNVNV 260
            :..:.|||...|:.:::
  Fly   253 LMSFADWIKMTIERLSI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 76/229 (33%)
Tryp_SPc 40..251 CDD:214473 75/228 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/239 (32%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.