DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30091

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:294 Identity:91/294 - (30%)
Similarity:143/294 - (48%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWML-ANQGSAQLLDQNCAEVSRLSNDII-------FSRPWMALVLLPNKT-----CSGAL 58
            :.:.:||| |.:|||:|||::|....:|...|:       ...|||||:    ||     |.|::
  Fly     6 VVLFAWMLTAGRGSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALI----KTNDEFICGGSV 66

  Fly    59 IHKYFVITSASCVFNQERAIVRLGQLSI---------KQEHIVSYSSDDYHVQSAYIHRFYEKSN 114
            |...||:|:|.|:...|..||:..||::         ..||  ::..:.|:|:..|||..:...|
  Fly    67 ITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEH--NHPHEIYNVERVYIHDSFAIQN 129

  Fly   115 FEHDIALLELQNDVLYKAHIRPICLWL-DKSDIDTQMFKRYETFRWGIDEKYILPAAKTS----- 173
            :.:|||||.||..::||..|:|:|:.| |:....|.:.:.:....||:...     .|.|     
  Fly   130 YRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGN-----GKMSNNLQM 189

  Fly   174 -KIKHISQVKCENAFKL---YPQNSHICAGYK-NKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQS 232
             ||..|.:..||.||..   ||.   .|||.. .:..|. ::|.||:..:.:....|.|..||.|
  Fly   190 VKIYRIDRKMCEAAFWYTFDYPM---FCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVS 251

  Fly   233 YGESRTC----LYTDVTKYIDWIMGVIQNVNVIV 262
            .| :..|    :||||..:||:|..::.:.::.|
  Fly   252 TG-TEDCRGFGMYTDVMGHIDFIERIVLDADIEV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 76/241 (32%)
Tryp_SPc 40..251 CDD:214473 76/240 (32%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 77/251 (31%)
Tryp_SPc 37..276 CDD:238113 78/253 (31%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.