DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30083

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:270 Identity:77/270 - (28%)
Similarity:128/270 - (47%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLSWMLANQGSAQLLDQNCA------EVSRLSNDIIFSRPWMALVLLPNK------TCSGALIHK 61
            :|.|..|   .:|.|:.||.      ::....|....:.||||.:...|.      .|.|.||||
  Fly    10 ILLWPGA---MSQFLEPNCGYPDISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHK 71

  Fly    62 YFVITSASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQN 126
            .||:::|.|:...:...||||:.|         ||..:.|..|:.::::...::.:||.:|.:|.
  Fly    72 QFVLSAAHCIKRDQILAVRLGEHS---------SSRYFAVTKAFRNKYFTTGSYSNDIGILRIQP 127

  Fly   127 DVLYKAHIRPICLWLDKSDIDTQMFKRYETFRWG-IDEKYILPAAKTSKIKHISQVKCENAFKLY 190
            .|.:.|.|||||:..|.:.:..  .|.::...|| .:.:......||.::..::..:|.|...:.
  Fly   128 IVKFNAVIRPICIITDPTKVPN--VKTFKAAGWGKTENETFSKVLKTVELNELNASECYNMLWVN 190

  Fly   191 PQNSHICAGYKNKSKCV-ETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC----LYTDVTKYIDW 250
            ...|.||||:.:...|. ::|.||...:.....:||...||.|:|.| .|    :||.::.:|||
  Fly   191 VTESQICAGHPDGDTCAGDSGGPLIHPVYMDGSLRYVQLGIISFGSS-LCNSPGVYTRLSSFIDW 254

  Fly   251 IMGVIQNVNV 260
            |:.|:.|..|
  Fly   255 ILMVVDNYTV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 65/223 (29%)
Tryp_SPc 40..251 CDD:214473 64/222 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 65/233 (28%)
Tryp_SPc 34..255 CDD:238113 65/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25741
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.