DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG30002

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:240 Identity:68/240 - (28%)
Similarity:110/240 - (45%) Gaps:32/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IFSRPWMALVLLPNK----TCSGALIHKYFVITSASC--VFNQERAI-VRLGQLSIKQ------- 88
            :.|:||||.:.:.:.    .|.|:||.:.||:|:|.|  :..:.:.| |.||:|.:..       
  Fly    70 LMSQPWMAFLHIASDLEMCRCGGSLISELFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTY 134

  Fly    89 --EHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIRPICLWL--DKSDIDTQ 149
              |.:.:...:::.:....:|..:......:||||::|...|::|.|||||||.|  :......|
  Fly   135 NYERVCAPPVEEFTIDKWILHEEFNLFYPGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQ 199

  Fly   150 MFKRYETFRWGIDEKYILPAAKTSKIKHISQVKCENAFKLYPQNSHICAGYKNKSKC-VETGSPL 213
            :.:|:....||..|.  |..|.::....|...||.:.    ...|.:||.......| .::|.||
  Fly   200 LGQRFMAVGWGKTES--LRYANSTMEVDIRTEKCTDG----RDTSFLCASGDYVDTCNGDSGGPL 258

  Fly   214 FKKIRYYTKIRYTLFGIQSYGESRTC------LYTDVTKYIDWIM 252
            ..|...:.|.|...||:.|.| |:.|      .|.||..|:.||:
  Fly   259 LWKTTLFGKDRAVQFGVVSTG-SQNCGAGHKAYYMDVPTYMPWIL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/236 (28%)
Tryp_SPc 40..251 CDD:214473 66/235 (28%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 66/237 (28%)
Tryp_SPc 62..301 CDD:238113 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.