DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and try-3

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:259 Identity:67/259 - (25%)
Similarity:108/259 - (41%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NDIIFSRPWMALVLLPNKT-----CSGALIHKYFVITSASCVFN-QERAIVRLGQLSIKQEHIVS 93
            |.|.....|||.::.....     |...:|..::::|:|.|... |.|:.|.:.:....:|.   
 Worm    42 NSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVREPKNNRER--- 103

  Fly    94 YSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKAHIRPICLWLDKSDIDTQMFKRYETFR 158
                .:.|:.||||..|.....::|||||.:.:| |.|..|:|:||..|    |:::.|:|:.  
 Worm   104 ----SFSVKEAYIHSGYNNQTADNDIALLRISSD-LSKLGIKPVCLVHD----DSKLLKQYKN-- 157

  Fly   159 WGIDEKYILPAAKTS---------------KIKHISQVKCENAFKLYPQNS------HICAG-YK 201
             |:...|.|...:.|               .:..||...|...::.....|      .|||| |.
 Worm   158 -GVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYL 221

  Fly   202 NKSKCVETGSPLFKKIRYYTKIRYTLFGIQSYGESR----------TCLYTDVTKYIDWIMGVI 255
            :.:...::|.||   :.:.:...|...||.|||...          ..:||.::||:.||.|||
 Worm   222 HGTAPGDSGGPL---LIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQGVI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 61/249 (24%)
Tryp_SPc 40..251 CDD:214473 60/248 (24%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.