DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG43742

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:134/264 - (50%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWMLANQGSAQLLDQNC-AEVS-RLSN--DIIFSRPWMALVLLPNKTCSGALIHKYFVITS 67
            |.:::.::.....|||||:|| .::: |::|  ..|.|:...||.......|.|:||||.:|:|:
  Fly     7 LLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQFMAALYNNSEFFCGGSLIHKQYVLTA 71

  Fly    68 ASCVFNQERAIVRLGQLSIK-----QEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQND 127
            |.||.:.:...|.||:.:..     .:|::..::      ...:|..:..:.|.:|||||.|:.:
  Fly    72 AHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNA------KVILHPNFHGNIFLNDIALLRLERE 130

  Fly   128 VLYKAHIRPICLWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQVKCENAFKLYPQ 192
            |:::|||||||:.||: |:.:.....:..:.||..|...:    :..:..|..|:...:. .|..
  Fly   131 VIFEAHIRPICIILDE-DVTSNNQNNFTAYGWGKTEHGNI----SDVLSFIDLVRLPKSM-CYQN 189

  Fly   193 NSHICAGYKNKSKC-VETGSPLFKKIRYYTKIRYTLFGIQSYGESRTC-----LYTDVTKYIDWI 251
            .:.||||..:...| .::|.||.....:..|.|..||||.|||::. |     :||||..|..||
  Fly   190 INTICAGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-CSGLFGVYTDVNAYKSWI 253

  Fly   252 MGVI 255
            ..|:
  Fly   254 ASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 67/222 (30%)
Tryp_SPc 40..251 CDD:214473 66/221 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 69/231 (30%)
Tryp_SPc 35..256 CDD:238113 70/233 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.