DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34436 and CG43125

DIOPT Version :9

Sequence 1:NP_001097954.1 Gene:CG34436 / 5740743 FlyBaseID:FBgn0085465 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:290 Identity:82/290 - (28%)
Similarity:134/290 - (46%) Gaps:78/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAVLSWMLANQGSAQLLDQNCAEVSRLSNDIIFS-RPWMALV---LLPNKTCSGALIHKYFVITS 67
            |||.:.:|..||||..|:|||.:.|      :|| .||:..:   |..|.||:|.||::.||:|:
  Fly     7 LAVFALLLFYQGSALFLEQNCGKSS------VFSPAPWLVKIRPELSSNITCTGTLINERFVLTA 65

  Fly    68 ASCVFNQERAIVRLGQLSIKQEHIVSYSSDDYHVQSAYIHRFYEKSNFEHDIALLELQNDVLYKA 132
            |||:..|...|||||::....::......::.:|..|.|||.|...:.:::||||.|:..|:||.
  Fly    66 ASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKK 130

  Fly   133 HIRPICLWLDKSDIDTQMFKRYETFRWGIDEKYILPAAKTSKIKHISQVKCENAFKLYPQNSHIC 197
            :|:|||:     |::.....:..||.  |::|      |..:.|                     
  Fly   131 NIQPICI-----DVNVGKVPKAPTFE--IEKK------KNEEPK--------------------- 161

  Fly   198 AGYKNKS---------------------------KCVETGSPLFKKIRYYTKIRYTLFGIQSY-- 233
               |||:                           :.:..|.||.|:|.  ....:..:||.|:  
  Fly   162 ---KNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGWPLTKQIN--ESALFHQYGILSHRN 221

  Fly   234 GESRTCLYTDVTKYIDWIMGVIQNVNVIVS 263
            .||:..:||||..|::||..:..:|::.::
  Fly   222 SESKKDVYTDVMAYVNWITPLALDVHITMA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34436NP_001097954.1 Tryp_SPc 40..252 CDD:304450 66/244 (27%)
Tryp_SPc 40..251 CDD:214473 65/243 (27%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.