DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34303 and CG33725

DIOPT Version :10

Sequence 1:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:154 Identity:37/154 - (24%)
Similarity:72/154 - (46%) Gaps:6/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNKTISEVEIHFKMVKRERGGWHPFFY 90
            :||.:.||............|.:||:.|:..::|.:..:....:.:.:|.|:.|: ..|:.|:..
  Fly    27 FKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKK-ANGFKPWLL 90

  Fly    91 DIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPYMEGTEMRLWNWSPDEDAVLAKFPVDHG 155
            |:::|.|:|.:.....|: .:|:...|.::.:||||||:....::.:...|::    .|.|...|
  Fly    91 DVKLDACRFVRTNFHPFV-RIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEK----LKLPFPSG 150

  Fly   156 TYGLQTTWYVKKEAALKVNGSVIF 179
            .|.|...|...|......|.|.::
  Fly   151 DYLLSLIWIFDKRPQFDTNVSFVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 22/83 (27%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 23/85 (27%)

Return to query results.
Submit another query.