DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34303 and CG33927

DIOPT Version :10

Sequence 1:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:163 Identity:42/163 - (25%)
Similarity:82/163 - (50%) Gaps:7/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VAFLCIFCFNIFVISKVHGS-YKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNKTIS 69
            |.:|.:|......:..::.| :||.:..|:.:......:..|.:|||.|....::.:..:.||||
  Fly     7 VLYLVLFFRIALELGSINASRFKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTIS 71

  Fly    70 EVEIHFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPYMEGTEM 134
            :..:|.::.|| ..|:.|:.|:|..|.|:|.:......:. ::::.:|.::|:|.|||||....:
  Fly    72 KFRVHGQIFKR-ANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTCPYMGPVHI 134

  Fly   135 RLWNWSPDEDAVLAKFPVDHGTYGLQTTWYVKK 167
            ...:...::..|    |:..|.|.:|..||:.|
  Fly   135 MGLHIIGEQIPV----PLPTGEYLIQIKWYISK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 21/83 (25%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:461928 22/85 (26%)

Return to query results.
Submit another query.