DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34453 and CG34454

DIOPT Version :9

Sequence 1:NP_001097458.2 Gene:CG34453 / 5740693 FlyBaseID:FBgn0085482 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster


Alignment Length:75 Identity:15/75 - (20%)
Similarity:23/75 - (30%) Gaps:22/75 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NSQLSNQLKLK-DLCPFVHNNQGESRFV-------SPEMYKPLLAV------------CR--CGR 88
            |..|.|.:::. .|.|||........|:       :...|.|:...            |.  ||.
  Fly    50 NLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCPTTSQYNPICGSNMQLYMNEEKFNCARFCGA 114

  Fly    89 TKESIHMGKC 98
            ..:.:..|.|
  Fly   115 DIQIVRRGSC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34453NP_001097458.2 None
CG34454NP_001097457.1 Surface_antigen 29..>76 CDD:287966 7/25 (28%)
KAZAL_FS 78..124 CDD:294071 6/45 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.