DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34453 and CG34454

DIOPT Version :10

Sequence 1:NP_001097458.2 Gene:CG34453 / 5740693 FlyBaseID:FBgn0085482 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001097457.1 Gene:CG34454 / 5740130 FlyBaseID:FBgn0085483 Length:133 Species:Drosophila melanogaster


Alignment Length:75 Identity:15/75 - (20%)
Similarity:23/75 - (30%) Gaps:22/75 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NSQLSNQLKLK-DLCPFVHNNQGESRFV-------SPEMYKPLLAV------------CR--CGR 88
            |..|.|.:::. .|.|||........|:       :...|.|:...            |.  ||.
  Fly    50 NLVLVNNVRIPGGLTPFVPAPAPTKEFLNCFGNCPTTSQYNPICGSNMQLYMNEEKFNCARFCGA 114

  Fly    89 TKESIHMGKC 98
            ..:.:..|.|
  Fly   115 DIQIVRRGSC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34453NP_001097458.2 None
CG34454NP_001097457.1 KAZAL_FS 86..124 CDD:412159 6/37 (16%)

Return to query results.
Submit another query.