Sequence 1: | NP_001097458.2 | Gene: | CG34453 / 5740693 | FlyBaseID: | FBgn0085482 | Length: | 175 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189014.1 | Gene: | CG42846 / 10178831 | FlyBaseID: | FBgn0262035 | Length: | 167 | Species: | Drosophila melanogaster |
Alignment Length: | 136 | Identity: | 23/136 - (16%) |
---|---|---|---|
Similarity: | 43/136 - (31%) | Gaps: | 42/136 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 VHNNQGESRFVSPEMYKPLLAVCRCGRTKESIHMGKCLQRALSPDYKQEMVQNGTDAWSAEPFNV 126
Fly 127 PSTSSSTIGFAAISKNYQKLERSM--------QYVSPAF---------------SMPGPRITAVP 168
Fly 169 YYNIII 174 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45469563 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |