DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS28-like and RPS28B

DIOPT Version :10

Sequence 1:NP_001097132.1 Gene:RpS28-like / 5740688 FlyBaseID:FBgn0085211 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_013366.1 Gene:RPS28B / 850969 SGDID:S000004254 Length:67 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:23/51 - (45%)
Similarity:35/51 - (68%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
            |:|||:|.|.|:||.:|:|||:.::......:|.||||||..||:...::|
Yeast    10 AKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESE 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS28-likeNP_001097132.1 Ribosomal_S28e 6..59 CDD:460109 22/49 (45%)
RPS28BNP_013366.1 S1_S28E 8..67 CDD:239904 23/51 (45%)

Return to query results.
Submit another query.