DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS28-like and RPS28B

DIOPT Version :9

Sequence 1:NP_001097132.1 Gene:RpS28-like / 5740688 FlyBaseID:FBgn0085211 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_013366.1 Gene:RPS28B / 850969 SGDID:S000004254 Length:67 Species:Saccharomyces cerevisiae


Alignment Length:51 Identity:23/51 - (45%)
Similarity:35/51 - (68%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
            |:|||:|.|.|:||.:|:|||:.::......:|.||||||..||:...::|
Yeast    10 AKVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVKGPVRENDILVLMESE 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS28-likeNP_001097132.1 S1_like 9..59 CDD:299122 22/49 (45%)
RPS28BNP_013366.1 S1_S28E 8..67 CDD:239904 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10769
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.