DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS28-like and RPS28

DIOPT Version :9

Sequence 1:NP_001097132.1 Gene:RpS28-like / 5740688 FlyBaseID:FBgn0085211 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_201219.1 Gene:RPS28 / 836535 AraportID:AT5G64140 Length:64 Species:Arabidopsis thaliana


Alignment Length:51 Identity:23/51 - (45%)
Similarity:35/51 - (68%) Gaps:1/51 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
            |.|:|::.|.|:||.:|:|||:..|..:. .||.||||||.||::...::|
plant     8 AVVVKVMGRTGSRGQVTQVRVKFTDSDRF-IMRNVKGPVREGDVLTLLESE 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS28-likeNP_001097132.1 S1_like 9..59 CDD:299122 22/49 (45%)
RPS28NP_201219.1 S1_S28E 6..64 CDD:239904 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1578965at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10769
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.