powered by:
Protein Alignment RpS28-like and Rps28
DIOPT Version :9
Sequence 1: | NP_001097132.1 |
Gene: | RpS28-like / 5740688 |
FlyBaseID: | FBgn0085211 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099200.1 |
Gene: | Rps28 / 691531 |
RGDID: | 621046 |
Length: | 69 |
Species: | Rattus norvegicus |
Alignment Length: | 57 |
Identity: | 25/57 - (43%) |
Similarity: | 37/57 - (64%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QPVASKARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
||: ..|||.|:|.|.|::|..|:|||:.:|......:|.||||||.||::...::|
Rat 7 QPI-KLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTLLESE 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1578965at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10769 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.980 |
|
Return to query results.
Submit another query.