DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS28-like and Rps28

DIOPT Version :10

Sequence 1:NP_001097132.1 Gene:RpS28-like / 5740688 FlyBaseID:FBgn0085211 Length:76 Species:Drosophila melanogaster
Sequence 2:NP_001099200.1 Gene:Rps28 / 691531 RGDID:621046 Length:69 Species:Rattus norvegicus


Alignment Length:57 Identity:25/57 - (43%)
Similarity:37/57 - (64%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QPVASKARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
            ||: ..|||.|:|.|.|::|..|:|||:.:|......:|.||||||.||::...::|
  Rat     7 QPI-KLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLTLLESE 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS28-likeNP_001097132.1 Ribosomal_S28e 6..59 CDD:460109 22/52 (42%)
Rps28NP_001099200.1 S1_S28E 10..69 CDD:239904 23/53 (43%)

Return to query results.
Submit another query.