powered by:
Protein Alignment RpS28-like and rps2802
DIOPT Version :9
Sequence 1: | NP_001097132.1 |
Gene: | RpS28-like / 5740688 |
FlyBaseID: | FBgn0085211 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_588343.1 |
Gene: | rps2802 / 2539085 |
PomBaseID: | SPCC285.15c |
Length: | 68 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 51 |
Identity: | 24/51 - (47%) |
Similarity: | 35/51 - (68%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
|:|||:|.|.|:||.:|:|||:.:|......:|.||||||..||:...::|
pombe 11 AKVIKVLGRTGSRGGVTQVRVEFMDDTSRSIIRNVKGPVREDDILVLLESE 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10769 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
3 | 2.970 |
|
Return to query results.
Submit another query.