powered by:
Protein Alignment RpS28-like and LOC108352027
DIOPT Version :9
Sequence 1: | NP_001097132.1 |
Gene: | RpS28-like / 5740688 |
FlyBaseID: | FBgn0085211 |
Length: | 76 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017452428.1 |
Gene: | LOC108352027 / 108352027 |
RGDID: | 11446793 |
Length: | 69 |
Species: | Rattus norvegicus |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 33/57 - (57%) |
Gaps: | 1/57 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 QPVASKARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDIVDFEDTE 59
||: ..|||.|:|.|..::...|.:||:.:|......::.|||||..||::...::|
Rat 7 QPI-KLARVNKVLGRTVSQDQCTHMRVEFMDDSNHSIIQNVKGPVGEGDVLTLLESE 62
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
RpS28-like | NP_001097132.1 |
S1_like |
9..59 |
CDD:299122 |
17/49 (35%) |
LOC108352027 | XP_017452428.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1578965at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.