DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34351 and Rgs7bp

DIOPT Version :9

Sequence 1:NP_001260044.1 Gene:CG34351 / 5740672 FlyBaseID:FBgn0085380 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_084155.2 Gene:Rgs7bp / 52882 MGIID:106334 Length:257 Species:Mus musculus


Alignment Length:233 Identity:56/233 - (24%)
Similarity:97/233 - (41%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RGSTAVELDK----ITNLNTLIVEINSHVALFRDMLIHVGQAK-DCPELREKIRKLRRTCVEALK 73
            |||.:....|    :.:...|:.|.|:.|||:|:::|.:|... .||.||.::.|.|....|..:
Mouse    36 RGSGSESAHKTQRALDDCKMLVQEFNTQVALYRELVISIGDVSVSCPSLRAEMHKTRTKGCEMAR 100

  Fly    74 HTAQILMPQVKSAMADGILTDNPHLVLLFYMAQ----LFLRELVKSYRLIQVVPMDMSGYYENRA 134
            ...|.|  ...|...||.:  :|.:..|:...|    ::..|::||..|:..:.....| .|...
Mouse   101 QAHQKL--AAISGPEDGEI--HPEICRLYIQLQCCLEMYTTEMLKSICLLGSLQFHRKG-KEASG 160

  Fly   135 GPSNLGNVISQIL-----------------LCKQFTPDFNEEELCSITKDSQDIAVLLAEMQEYM 182
            |..||.:.|.:..                 .|.|...|....|     :|.:::..||::::|.|
Mouse   161 GAKNLDSKIEENAETPALEDSLSSPLESQQQCWQVATDIENTE-----RDMREMKNLLSKLRETM 220

  Fly   183 PQHEAYLERNAALDTTGPWQAKRRQNYICKNMSLLCCV 220
            |......:.::.|:.| |:...||:.   :....|||:
Mouse   221 PLPLKNQDDSSLLNLT-PYPMVRRRK---RRFFGLCCL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34351NP_001260044.1 Syntaxin_2 27..>77 CDD:291208 16/50 (32%)
Rgs7bpNP_084155.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 3/8 (38%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:16574655, ECO:0000269|PubMed:16867977 242..247 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843061
Domainoid 1 1.000 45 1.000 Domainoid score I12149
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5489
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.